PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008224716.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family TALE
Protein Properties Length: 383aa    MW: 42812.8 Da    PI: 6.7909
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008224716.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.5e-093103442155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yps++++  LA+++gL+++q+ +WF N+R ++
  XP_008224716.1 310 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 344
                     569*****************************885 PP

2ELK413.9e-14264285122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK qLlrKYsgyLgsLkqEF+
  XP_008224716.1 264 ELKGQLLRKYSGYLGSLKQEFM 285
                     9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.6E-19121165IPR005540KNOX1
PfamPF037904.4E-22123161IPR005540KNOX1
SMARTSM012567.9E-27175226IPR005541KNOX2
PfamPF037912.5E-21179225IPR005541KNOX2
SMARTSM011882.8E-8264285IPR005539ELK domain
PROSITE profilePS5121311.174264284IPR005539ELK domain
PfamPF037896.4E-11264285IPR005539ELK domain
PROSITE profilePS5007112.989284347IPR001356Homeobox domain
SMARTSM003897.4E-13286351IPR001356Homeobox domain
SuperFamilySSF466891.2E-19286362IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-28289349IPR009057Homeodomain-like
CDDcd000861.92E-12296348No hitNo description
PfamPF059207.0E-17304343IPR008422Homeobox KN domain
PROSITE patternPS000270322345IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MEGGSNGTCS MMAFGENSSN GGGLCPMMMV PALMTSHHSH HYHHQHHHPT NPTNADPNTT  60
TPFQLPQLPP SNHNRNSSTS SFIFNDHHPN NNNNNHPAAA AACYFMDNNN SNHDGSSSSS  120
SSVKAKIMAH PHYHRLLASY INCQKVGAPP EVVARLEEAC SSAASIGQMM SSSSGSGCLG  180
EDPALDQFME AYCEMLTKYE QELSKPFKEA MIFLQRIESQ FKALTLSSSS DSAVCGDGLD  240
RNGSSEEEVD VNNNFIDPQA EDRELKGQLL RKYSGYLGSL KQEFMKKRKK GKLPKEARQQ  300
LLDWWSRHYK WPYPSESQKL ALAESTGLDQ KQINNWFINQ RKRHWKPSED MQFVVMDATH  360
PGHYYMDTVL GNPFPMDISP TLL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1279288LKQEFMKKRK
2285289KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ3642320.0DQ364232.1 Prunus dulcis homeodomain protein Kn1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008224716.10.0PREDICTED: homeobox protein knotted-1-like LET6
SwissprotP466081e-155HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLE9JGZ00.0E9JGZ0_PRUPE; Class 1 KNOTTED-like transcription factor STM-like2
STRINGVIT_10s0116g00190.t011e-171(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-141KNOX/ELK homeobox transcription factor